SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059613|ref|YP_003137501.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059613|ref|YP_003137501.1|
Domain Number 1 Region: 24-142
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.2e-32
Family N-utilization substance G protein NusG, N-terminal domain 0.0000992
Further Details:      
 
Domain Number 2 Region: 123-207
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.71e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257059613|ref|YP_003137501.1|
Sequence length 208
Comment transcription antitermination protein NusG [Cyanothece sp. PCC 8802]
Sequence
MTFAQDQSPELQQSEQGQEAPKTARWYAVQVASGCEKRVKTNLEQRIHTLDVADRILQVQ
IPKTPTIKVRKDGSRQHGEEKVFPGYVLVRMIMDDDAWQVVKNTPHVINFVGAEQSRGTG
RGRGHVRPVPLSPGEIERIFKQSEVQEPVVKIDTMVGDKIMVLSGPFKDFEGEVVEVSPE
RGKLRALLSIFGRDTPVELEFNQIEKLN
Download sequence
Identical sequences B7JWT9
gi|257059613|ref|YP_003137501.1| WP_012595061.1.62203 WP_012595061.1.93053 395962.Cyan8802_1765 41431.PCC8801_1741 gi|218246573|ref|YP_002371944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]