SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059684|ref|YP_003137572.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059684|ref|YP_003137572.1|
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily CheY-like 1.04e-40
Family CheY-related 0.001
Further Details:      
 
Domain Number 2 Region: 159-230
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.22e-20
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257059684|ref|YP_003137572.1|
Sequence length 231
Comment two component LuxR family transcriptional regulator [Cyanothece sp. PCC 8802]
Sequence
MSNPEKILLVDDEPGVRESVQAYLEYSGDFNVKVASNANQAWELIEKEIPDLIISDIMMP
QVDGYQFLGKLREDPRYQSLPVVFLTARGMTSDRIQGYHAGCDAYLSKPFDPEELEAIVK
NLLERRKVSIKASSESVKLEEIAQEIREIKAQIGQQPHLVTTPSPIKIELTPREQSVLDL
VAEGLMNKEIASRLNTSVRNVEKYVSRLFSKTGTNSRTELVRFALKHGLTQ
Download sequence
Identical sequences B7JX08
WP_012595129.1.62203 WP_012595129.1.93053 gi|218246642|ref|YP_002372013.1| 395962.Cyan8802_1838 41431.PCC8801_1812 gi|257059684|ref|YP_003137572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]