SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257059875|ref|YP_003137763.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059875|ref|YP_003137763.1|
Domain Number 1 Region: 62-160
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 0.0000102
Family Leukotriene A4 hydrolase N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257059875|ref|YP_003137763.1|
Sequence length 184
Comment hypothetical protein Cyan8802_2037 [Cyanothece sp. PCC 8802]
Sequence
MKIRSFRFLTLLTLSTTILVVTPTVLTQDLPFPANATFFTGQPPTLVSAGTPDNAINWPS
AHYYFTFNVPNASSQSVGKVTIEQETNVETIQFNLSNTTAFQGTQDNPGQSLTVKVTENT
QDQAIAITFDPPVPPNSTFTIRLEANQNPSTQGTYIFRVKAFPNGDNPIGLDLGVGRISF
YQNF
Download sequence
Identical sequences WP_015783956.1.62203 395962.Cyan8802_2037 gi|257059875|ref|YP_003137763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]