SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060046|ref|YP_003137934.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060046|ref|YP_003137934.1|
Domain Number 1 Region: 361-548
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.4e-45
Family Pyruvate oxidase and decarboxylase PP module 0.0000619
Further Details:      
 
Domain Number 2 Region: 1-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.4e-44
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000249
Further Details:      
 
Domain Number 3 Region: 161-336
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.58e-37
Family Pyruvate oxidase and decarboxylase, middle domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257060046|ref|YP_003137934.1|
Sequence length 552
Comment thiamine pyrophosphate protein TPP binding domain-containing protein [Cyanothece sp. PCC 8802]
Sequence
MMTIGEYLFQRLKELGVDHVFGVPGDYVLGLMDVLIKSPLELICTCNELNAGYAADAYAR
IRGLGVVCITYGVGGFSLVNAVVGAYAERVPLVVISGAPNSAVRKNHLLLHHTTGDYNLQ
LSIMEKVTVASVILTQASQAAKQIDEVLSACLHYKRPVYIEIPLDVVNQPCTFSESSLNA
IPQLTELTDNDALKEAITEASELLKKAKNPIILAGVEIDRFQLKEPLIKLLETTGYPIAT
TILGKSCLPEVHPQFIGNYVGALSRDYVRQRVENADCILCLGAIMSDMNLGIYTAQLDTQ
KLINANSEKVKIKHHFYQPIYLGDFIAGLIPNLSYQESNPLNIQPAIKRLSKTFEFKTED
KLTSGRFYEAINHFLDNDLLVISDTGDSIIASIDLLMHKGSDFIGQAFYLSIGYSIPACL
GASFAAPDKRIIVLVGDGAFQMTAQELSTIIRHQLNPIIFLINNDGYTIERVIHDGIYND
LQAWKYHELPHIFGESWSCEVSTEGELQKALLYAKMNTHCVCFIEVHLDRFDCSPGLIRL
GKAIEKMQKLSN
Download sequence
Identical sequences WP_015784056.1.62203 395962.Cyan8802_2218 gi|257060046|ref|YP_003137934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]