SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060153|ref|YP_003138041.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060153|ref|YP_003138041.1|
Domain Number 1 Region: 14-224
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.1e-30
Family Prokaryotic proteases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060153|ref|YP_003138041.1|
Sequence length 240
Comment hypothetical protein Cyan8802_2330 [Cyanothece sp. PCC 8802]
Sequence
MQWTLNYQKFWLIFLGIVISSEVAIAVPKPLEKIAKEITVRVVGKSGGTGILIDRRKNSY
TVLTNAHVFKQPGERAIITNDGKCYPIIPKTIQTLPQLDLAVLVFSSPVNYSLAKMGKSE
QLTPNQTVYVSGWAASGGTLHSRVFLITEGELIQTNSSLPLGYRLTYTNLVRVGMSGGSV
LDEQGNVVGINGIVHFANNTSDQIVASAIPINSFIPWYNQHKNKLPLPPVTTTKCQNNWQ
Download sequence
Identical sequences WP_015784112.1.62203 gi|257060153|ref|YP_003138041.1| 395962.Cyan8802_2330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]