SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060177|ref|YP_003138065.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060177|ref|YP_003138065.1|
Domain Number 1 Region: 95-233
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.69e-40
Family Pentapeptide repeats 0.0003
Further Details:      
 
Weak hits

Sequence:  gi|257060177|ref|YP_003138065.1|
Domain Number - Region: 22-62
Classification Level Classification E-value
Superfamily YfgJ-like 0.000196
Family YfgJ-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257060177|ref|YP_003138065.1|
Sequence length 234
Comment pentapeptide repeat-containing protein [Cyanothece sp. PCC 8802]
Sequence
MPTCVKNSSQKFTYLISSNDHRNTIRYDQDFHTQHICPCCSYLLLRHIDCQGIYWYCSHC
HQQMPAYNSLKILAIKNEEINMNAQEILQKYADGERDFSRVTLVHVCLCNANLVGVHLDG
ADLILANLKGAALTEAHLEQAKLNQSNLADAKMIRACLIGAQMIDADLSGADLRGADLRE
ANLSGAKLGGADLRNTRLEGTDLTGADLRGADLTGVNLQETDLLGADLTGAYIN
Download sequence
Identical sequences B7K1C8
395962.Cyan8802_2355 41431.PCC8801_2304 gi|257060177|ref|YP_003138065.1| WP_012595591.1.62203 WP_012595591.1.93053 gi|218247108|ref|YP_002372479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]