SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060223|ref|YP_003138111.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060223|ref|YP_003138111.1|
Domain Number 1 Region: 89-546
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.26e-111
Family Amylase, catalytic domain 0.00000000747
Further Details:      
 
Domain Number 2 Region: 553-658
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.01e-27
Family alpha-Amylases, C-terminal beta-sheet domain 0.0008
Further Details:      
 
Domain Number 3 Region: 43-106
Classification Level Classification E-value
Superfamily E set domains 0.00000000217
Family E-set domains of sugar-utilizing enzymes 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257060223|ref|YP_003138111.1|
Sequence length 659
Comment 1,4-alpha-glucan branching protein [Cyanothece sp. PCC 8802]
Sequence
MNNTEAHPNSLFSDFDLYLFGQGQHHKIYEKLGAHPVEFNGTKGVYFAVWAPSAHEVAVI
GDFNHWNRDTHLMKRIEGGNPGIWELFIPNIGVGEKYKFAIKNHHKETVEKTDPYGYQQE
VRPATASIVTDLSYTWDDQDWLEKRAQTNPQEQPVSVYEVHLGSWKHTSWDNQPKNGVPV
GVPYKDNARFLNYRELADELIPYVKEMGYTHIELLPVTEYPFDGSWGYQVVGYYAVTSRY
GTPQDFMYFVDQCHQQGLGVIIDWVPGHFPKDSHGLARFDFTALYEYEDPRKGEHLEWGT
LVFDYGRNEVRNFLMASAIFWFEMYHIDGIRVDAVSSMIYLNYQREPGQWVPNQYGGDDN
IEAVSFLRELNKTIFGYYPGILSIAEEATEWKDVSRPIEGGGLGFNFKWNMGWMNDTLKY
FLINPHDRSSYHNKLTFSLWYAFNENFMLALSHDEVVHGKGHLFQKMGGQGGISDWDRIA
NLRVLFAYMFTHPGKKTLFMGMEFGQTHEWRYNLDLEWFLLDSELHWKLKKLVQDLNTIY
RTEPALYTDDFTPNGFQWIDCHDAGRGMLSFIRKDKFTHEKIVVVCNFKDYDQYNYWLGV
PDHGNYIELINTDSHTYGGSGKGNLSPMHSKQWNTEHFHNALEITVPKFSAIMFKLKRD
Download sequence
Identical sequences B7K2H3
395962.Cyan8802_2403 41431.PCC8801_2353 WP_012595634.1.62203 WP_012595634.1.93053 gi|257060223|ref|YP_003138111.1| gi|218247151|ref|YP_002372522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]