SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060285|ref|YP_003138173.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060285|ref|YP_003138173.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 1.83e-46
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00036
Further Details:      
 
Domain Number 2 Region: 160-316
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.55e-29
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00033
Further Details:      
 
Domain Number 3 Region: 318-422
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 3.53e-28
Family Glutamyl tRNA-reductase dimerization domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257060285|ref|YP_003138173.1|
Sequence length 428
Comment glutamyl-tRNA reductase [Cyanothece sp. PCC 8802]
Sequence
MNIAVVGLSHKTAPVEVREKLSIQEAKLEEALTHLRGYPHIEEVAIISTCNRLEIYAVVS
DTEKGVVEITQFLSETGHLPLNYLRRYLFTLLHQDAVRHLLRVAAGLESLVLGEGQILAQ
VKTTHKLGQKYKGIGRLLDRLFKQAITAGKRVRSETNIGTGAVSISSAAVELAQTKAEDL
ANRRISIIGAGKMARLLVQHLLSKGATDITIVNRSHHRAQELAAQFPQASLNLQLLPEMM
QVVASSHIVFTSTAATEPILHRENLTAALDPNHALMLFDISVPRNVASDVHGMEGIESYN
VDDLKAVVAQNYESRRQMAQEAEGLLEEEVEAFDLWWRSLETVPTISCLRTKVETIREQE
LEKALSRLGTEFAEKHQEVIEALTRGIVNKILHEPMVQLRAQQDIEARKRCLESLKMLFD
LEIEEQFG
Download sequence
Identical sequences B7K1R5
gi|257060285|ref|YP_003138173.1| WP_012596865.1.62203 WP_012596865.1.93053 395962.Cyan8802_2469 41431.PCC8801_3645 gi|218248392|ref|YP_002373763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]