SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060315|ref|YP_003138203.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257060315|ref|YP_003138203.1|
Domain Number - Region: 10-138
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0282
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060315|ref|YP_003138203.1|
Sequence length 157
Comment hypothetical protein Cyan8802_2501 [Cyanothece sp. PCC 8802]
Sequence
MTIDIPEPIKIWSQFGHPILMWVLLGLTIYALYLGIQWRRTRTADKDLKKELLPKDFRTR
HYQLGSLLLALMVLGNIGGMAVTYINNGKLFVGPHLLIGLTMTGMIALSAGLSPLMQKGN
ELARYTHITLNMIIVGLFGWQAVSGMEIVQKILDKMS
Download sequence
Identical sequences B7K1N3
gi|218248360|ref|YP_002373731.1| 395962.Cyan8802_2501 41431.PCC8801_3613 gi|257060315|ref|YP_003138203.1| WP_012596833.1.62203 WP_012596833.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]