SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060333|ref|YP_003138221.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060333|ref|YP_003138221.1|
Domain Number 1 Region: 17-72
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000806
Family Alr1493-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060333|ref|YP_003138221.1|
Sequence length 119
Comment hypothetical protein Cyan8802_2520 [Cyanothece sp. PCC 8802]
Sequence
MTNLEDYFNILSPNDIRLKNSRIGIETLLYEYIYRAKNPEDIAQLYPSLTLEQIYATILY
YLHNKKTITNYMTNWLEYCLKSAQEQDENPPEHLVKLRQLKAERTTKISNINEYSVSTR
Download sequence
Identical sequences B7K1L4
gi|257060333|ref|YP_003138221.1| gi|218248341|ref|YP_002373712.1| WP_012596814.1.62203 WP_012596814.1.93053 395962.Cyan8802_2520 41431.PCC8801_3594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]