SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060449|ref|YP_003138337.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060449|ref|YP_003138337.1|
Domain Number 1 Region: 374-695
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 1.64e-95
Family Phosphotransacetylase 0.000000121
Further Details:      
 
Domain Number 2 Region: 1-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.46e-23
Family Nitrogenase iron protein-like 0.072
Further Details:      
 
Domain Number 3 Region: 211-330
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 2.55e-22
Family DRTGG domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257060449|ref|YP_003138337.1|
Sequence length 707
Comment phosphate acetyltransferase [Cyanothece sp. PCC 8802]
Sequence
MTNSLYIATTEGKTGKSLISLGIMELLLRKTTKVGFFRPIIQDPIDHQPDQHLNLILSHF
NLPQNYEESYGLPYSEVSNLMGHQNLDEILEIIITKYKKLEETCDFILCEGSDYLKESSA
FEFDINAKIAKNLGCSILILGNGYQKSVEEAIAPIEIAVDTYREKQCPIIGIIINKADQS
QFKLLKNVLEKDYKNTNYLLSIIPYDKKLGSPRIREIAQQLNAQILYGRDRLDNLVFNYL
VAAMQMQHAISQFDENCLVVTPSDRGDVIIGTLQAHQSTNYPNLAGILLTTEYQLEQSIA
QLISGLTDPLPILWVNSYTYPTVSDLKAVYSSLIPEDTEKIDWSIDLFDQFVNLTTLEKQ
ISTIEVKGITPKMFTYNLIQQAKTQKRHIVLPEGNEPRILKAAEVLLSKNIVDLTLLGQK
KEIERIVKTNNIQLDIQQLTIINPIESAKFDDYVQTFYDLRKHKGATLETAHDCIMDVSY
FGTMMVYKGDADGMVSGAIHTTSHTIRPALQIIKTQPDISLVSSVFFMCLNHNVLVYGDC
AVNPNPTAEELAEIAITSAETAKTFDITPKVALLSYSSGESGQGEEVEKVRKAAQIAQKR
RQDLAIEGPIQYDAAIDPQVAAQKMPNSRVAGQATVFIFPDLNTGNNTYKAVQRATGAIA
IGPILQGLKKPVNDLSRGCTVGDIINTVVITAIQSQIHLTGRMGNGQ
Download sequence
Identical sequences WP_015784278.1.62203 gi|257060449|ref|YP_003138337.1| 395962.Cyan8802_2640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]