SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060487|ref|YP_003138375.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060487|ref|YP_003138375.1|
Domain Number 1 Region: 18-437
Classification Level Classification E-value
Superfamily Clc chloride channel 3.01e-95
Family Clc chloride channel 0.00000332
Further Details:      
 
Domain Number 2 Region: 449-573
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-32
Family CBS-domain pair 0.00065
Further Details:      
 
Domain Number 3 Region: 602-733
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.03e-16
Family Universal stress protein-like 0.011
Further Details:      
 
Domain Number 4 Region: 750-876
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000159
Family Universal stress protein-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257060487|ref|YP_003138375.1|
Sequence length 879
Comment chloride channel core [Cyanothece sp. PCC 8802]
Sequence
MKPHLIVKRLYQWVKSSHLGVNATDSRYAFVEACLLGLLSGIAALILKEGVGWLGGWRVS
LANQLGAIWVLPLGGLFLGSMAGWLIEQTSPTAAGGGITQVKAALARYPVPLSLRVAVVK
LIGTILVLGGGLTLGRRAPTVHVGAALAAQLSSWVPTSPEHRRQMIAAGAAAGLAAGFGT
PIAGVLFVVEELMRDVSGLTLQTSIIASFTGAVVSLIVEARSLSFAPLLNLPNISFSVDD
IPFYLLLGILAGFLGALFKQGLLFSLAIQSRLKLPLPWRIGLVAMISGLIIALLPPFFQD
NTRLQTVLVRGELSTEKIFLAFVAHFFLTMLAYSSNAPGGLFAPALVLGSALGYLVGDLE
QFIMGSSSQSAFALAGMGGFFSAVVGVPVTAIVIVFELNSNFNIVLPLMVTSSVAYVVAD
SFSRGSLYERMLKARGIYLDNNPVVQDFLSQLTAADVMQSQVETLPSDLTLDQVIQAMSL
SSHRGFPVMEEGKLVGIVTQTDVANAAKLSSQTPVKQFMTPRPISVEADALLSDVLYLLN
RYQLSRLPVTEGSKLVGIITRTDIIRVEANQLEGNDSKLNEAIPEPSYIAYQTRAPATGG
GRILLPLADPKTATALFQIGAAIARQQNDELECLQVIKVPKHKKPAQTPVKSQHSRHLLH
RMERLGRRQKLPVHTQVRVAHDIAQGILDTIRERHINLMVMEWNGETGTPGAIFGHVVDL
LIRKAPCELVLVKLGNREPSYPDSLNRDATWLIPIAGGPNAQRALELLPGLTGLYDRPRS
PIIWLCKVFPPAGALPDYQVLEQTAQAVKDAVARPVIPLPIRSQSVADAVVHLAAAETCD
VVMLGVSREGLLEQVIHGNIPKAIAKQVDSTVILVRGAL
Download sequence
Identical sequences B7K0C0
395962.Cyan8802_2680 41431.PCC8801_3436 WP_012596664.1.62203 WP_012596664.1.93053 gi|218248189|ref|YP_002373560.1| gi|257060487|ref|YP_003138375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]