SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060498|ref|YP_003138386.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060498|ref|YP_003138386.1|
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily Ava3019-like 4.84e-43
Family Ava3019-like 0.0000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257060498|ref|YP_003138386.1|
Sequence length 145
Comment hypothetical protein Cyan8802_2691 [Cyanothece sp. PCC 8802]
Sequence
MSSSQNNLTVDEAIKILKSYSCVQIKVMRFELDKEVLRQAIKLITGLSDHENFGICADNL
QQGLQALRSYLKALNYNFELNKNPFPSEDTAVYIKFNTQTQKYYLDSYQGTYRGVLISCQ
SEDNSLVGTYGHFPLDLFESTFENE
Download sequence
Identical sequences WP_015784306.1.62203 gi|257060498|ref|YP_003138386.1| 395962.Cyan8802_2691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]