SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060573|ref|YP_003138461.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060573|ref|YP_003138461.1|
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily L21p-like 1.44e-35
Family Ribosomal protein L21p 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060573|ref|YP_003138461.1|
Sequence length 123
Comment 50S ribosomal protein L21 [Cyanothece sp. PCC 8802]
Sequence
MSYAIIEAGGQQLKVEPGRFYDINYLGVDPDSDYTIDKVLLINHEDDITVGQPYVEGATV
EGTIVEHRRGRKIIVYKMRPKKKTRKKRGHRQELSRLMITSIKVNGSVIVDDSAVMTETS
EEE
Download sequence
Identical sequences B7JZA4
gi|257060573|ref|YP_003138461.1| gi|218248100|ref|YP_002373471.1| 395962.Cyan8802_2771 41431.PCC8801_3346 WP_012596576.1.62203 WP_012596576.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]