SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060608|ref|YP_003138496.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060608|ref|YP_003138496.1|
Domain Number 1 Region: 42-199
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.54e-23
Family SOUL heme-binding protein 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060608|ref|YP_003138496.1|
Sequence length 201
Comment hypothetical protein Cyan8802_2809 [Cyanothece sp. PCC 8802]
Sequence
MKLQHLFLLVGVVAIAALAVGVYHASSAPLPEGFPSPTPPGQIEIKQYPGYRRATYRYQG
ELSQAANQSFYPLYQHISANEISMTAPVETRYPSSTLDENSRLNASGEAQVSFLYRNSQI
YPDQVAENIEVEDIPPMTVVSVGLQGGYSYQSYQESLQRLKDWLTDHPQYQVIGQPRRFF
YDGPYTPDGIKRSEIQIPIQF
Download sequence
Identical sequences B7JZ68
gi|257060608|ref|YP_003138496.1| 395962.Cyan8802_2809 41431.PCC8801_3308 WP_012596540.1.62203 WP_012596540.1.93053 gi|218248064|ref|YP_002373435.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]