SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060611|ref|YP_003138499.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060611|ref|YP_003138499.1|
Domain Number 1 Region: 35-256
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 7.65e-32
Family DNA/RNA non-specific endonuclease 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257060611|ref|YP_003138499.1|
Sequence length 301
Comment DNA/RNA non-specific endonuclease [Cyanothece sp. PCC 8802]
Sequence
MVGYQPDFLGADQILDLPRVSPEQTGNIVRSEQLREGFILDYPNYSVVMNGETRQAFFSA
ANADFRNNNGEGRSFRIDSRIDVDFQLDDIYYRNLDGIENPYDRGHLTRRAAVAWGETQK
QANDASRDSCYFPNVSLQHRNFNQDEWNALERAVETNETDLNDKFNIFVGPIFTPMDRFL
QPTPRLEPARIPSAFWKIIAYIGRESQQLETKAFIVFQDDMAIQGMNQVLNNPQLDPFSI
YQSSTTLIEQLTGLEFPEVLFERNPLFFFANSRTTERNIVTPQLNRVTPLASNNSQIIFQ
Q
Download sequence
Identical sequences WP_015784359.1.62203 395962.Cyan8802_2812 gi|257060611|ref|YP_003138499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]