SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060771|ref|YP_003138659.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060771|ref|YP_003138659.1|
Domain Number 1 Region: 63-85,112-479
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.09e-27
Family Galactose oxidase, central domain 0.0059
Further Details:      
 
Domain Number 2 Region: 550-652
Classification Level Classification E-value
Superfamily E set domains 1.54e-22
Family E-set domains of sugar-utilizing enzymes 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257060771|ref|YP_003138659.1|
Sequence length 652
Comment hypothetical protein Cyan8802_2977 [Cyanothece sp. PCC 8802]
Sequence
MIMQPFSKQIKIISIFLVFFLALCLTFLGWEEAIASPTPGPKETMGLWETLPLPPPEDRM
QSVHTVVLPNGKVLVVNGSSFRSFLVLENGEYKFTQFTEGVDVKNYDVVNNTGILDPETG
KFERISSPPALQYGTTNDLFCVGHLQLADGNVLFVGGTGRYYPGGAFTGTKQINLYNWRT
GEWKAIGEMKDGRWYPSLIPLADGKVVIFSGLKWGGPNQINPSIEIYDPKTEKLSYFDPR
TLKNSPFNTKVESEDIYDSIDLYPRVFPLKDGRLLITGDEAGIAGVLVPHSSKKSYLMSI
NEDATGKLAISFEVGPDRLETSKAYGTALQVPNSEDVLLLGGIIGTNSIAFGRGGNTDGF
PGAKVVASLQHWRSPENSGENNGKWEIFPNFLGTPRANLQAVILPDKEILVLNGGQYPEY
LPVYEPLLMTPDPSKPSGYKTQSLNSAKLPRLYHNGAVLLPDARVLVLGGNANRAAREAN
GTVHVDIVGDQTSFFALAKLHNKAGEPEDFDLNTFYADPQHYYAENDKEPFVPAEIWQGE
IFSPPYIFKPGSRPEISNAPETLKYGEIGTITVKDATKDGSLVLVKLGSVTHSFDFGQRL
AELPINNVVVGDESTLEFTAPENANLYPPGYYMMFYLNDLGKPSHAKMVKLG
Download sequence
Identical sequences B7JXD4
WP_012596383.1.62203 WP_012596383.1.93053 395962.Cyan8802_2977 41431.PCC8801_3142 gi|257060771|ref|YP_003138659.1| gi|218247907|ref|YP_002373278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]