SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060804|ref|YP_003138692.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060804|ref|YP_003138692.1|
Domain Number 1 Region: 554-971
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-143
Family DNA polymerase I 0.00000000761
Further Details:      
 
Domain Number 2 Region: 7-187
Classification Level Classification E-value
Superfamily PIN domain-like 1.04e-46
Family 5' to 3' exonuclease catalytic domain 0.0000239
Further Details:      
 
Domain Number 3 Region: 361-546
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.79e-45
Family DnaQ-like 3'-5' exonuclease 0.0000836
Further Details:      
 
Domain Number 4 Region: 188-303
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 7.03e-30
Family 5' to 3' exonuclease, C-terminal subdomain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257060804|ref|YP_003138692.1|
Sequence length 972
Comment DNA polymerase I [Cyanothece sp. PCC 8802]
Sequence
MQTQQSLPLLILIDGHSLAFRSYYAFAKARKGPLRTSKGIPTSVCFGFLNSLMQVIESQK
PEYLAIAFDRSEPTFRHEADENYKADREETPEDFIIDMANLQELLEALNLTIVTFPGYEA
DDVLGTLANQGSESGYQVKIVSGDRDLFQLVDEAKNISVLYLERNAVKGSSEGYTEFNSE
AVEAKLGIKPVQVVDYKALCGDKSDSIPGIDGIGEKTAVKLLKEYGTIQEVYNNLDKIKG
TLNKKLKDGVKEAEHSQYLAKIVVDVPVDIDFKNCQLKGFNLSILEPLLQKLELNKFLKQ
INHLQQKFGGEVKPVDQATSQPLDHPQQLSLFPEQNLPAHSVEPLVIKTIPEVSPITPKI
ITTLDDLNHLINKLEQYTDVEYPVAWDTETTSLEPRNAELVGIGCCWGEKSTDIAYIPTG
HNKGNQLKKEAVLQALKPILESDRYPKVFQNTKFDRLIFYHQGINLKGVVFDTLLASYVL
HPEMSHNLSDLCYRYLSGITSQSYKELAIPKGKTIASLDIETVANYCGLDAYATFLLVSK
LKQELKSFPSLEKLLLEVEQPLEPVLAAMEDIGIRIDTDYLQQLSQQLEQDLHIIEQQAY
QEAGEIFNLGSPKQLGEILFEKLELNRKKSRKTKTGYSTDHATLEKLQGDHPIIDHILDY
RTLSKLKSTYVDALPALVRPDTQRVHTNFNQTVTATGRLSSSNPNLQNIPIRTEFSRKIR
QAFIPQENWLLVSADYSQIELRILAHLSQEVVLLEAYRNNQDVHSVTAKLLFDKETITPQ
ERNLGKTINFGVIYGMGAQRFAREAGVSAAEGKTFINKYRQRYAKVFDYLERMKKEAIAD
GFVTTILGRRRYFNFITESLQKLKGSDPEKINLEVLNINYADAQLLRAAANAPIQGSSAD
IIKIAMIKMQEILSHYQARLLLQVHDELVFEIPLNEWEELQTKIKETMENAVTLTVPLVV
EIHSGNNWMEAK
Download sequence
Identical sequences B7JXA2
gi|257060804|ref|YP_003138692.1| 395962.Cyan8802_3011 41431.PCC8801_3109 gi|218247875|ref|YP_002373246.1| WP_012596351.1.62203 WP_012596351.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]