SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060842|ref|YP_003138730.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257060842|ref|YP_003138730.1|
Domain Number - Region: 55-165
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.00288
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.023
Further Details:      
 
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0261
Family Transcriptional factor domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060842|ref|YP_003138730.1|
Sequence length 179
Comment transcriptional regulator NrdR [Cyanothece sp. PCC 8802]
Sequence
MQCPYCQHTNSRVLESRSSEGGQSIRRRRECLCCKHRFTTYERIEFVPITVIKHDGKKES
FDPSKLLRGMVRACEKTGISYQKLETIVDDIEAQLQQRTQREVTSQEIGQLVLKYLRQEN
EVAYIRFASVYGRFQGIKDFVDTLKQLQEEDLVPSETIWKPANDDFSEQETPSTVMMPS
Download sequence
Identical sequences B7JX64
gi|218247837|ref|YP_002373208.1| WP_012596313.1.62203 WP_012596313.1.93053 gi|257060842|ref|YP_003138730.1| 395962.Cyan8802_3049 41431.PCC8801_3071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]