SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060969|ref|YP_003138857.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060969|ref|YP_003138857.1|
Domain Number 1 Region: 128-306
Classification Level Classification E-value
Superfamily E set domains 1.35e-63
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000581
Further Details:      
 
Domain Number 2 Region: 44-157
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-27
Family Voltage-gated potassium channels 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257060969|ref|YP_003138857.1|
Sequence length 307
Comment K channel inward rectifier domain-containing protein [Cyanothece sp. PCC 8802]
Sequence
MKQFKKMAKFRSLLRPSLGNKNSSHKVSRPLQNSQKIDLFHPARSDLYHWLLSLSWRKFL
LLVTLFYFTLNIFFAFAYLSIGDGIANAEPGSFKDAFFFSIQTLSTVGYGSMYPQTFYAQ
LLMTIEVWMGLLLIAILTGLMFARFSRPTARVHFSQVAVVCSFDGIPTLMFRAANRRTNR
ILEAQIQVSLVRNEVTQEGHQLRRFYDLKLLRSRSPIFGLSWQVMHPIDQTSPLYGNCAE
YLEQVEGEIWVTLTGLDETFSQTIHARHSYSSDEILWNMRFVDIFSRTSDGRYQIDLSRF
SDVIPLN
Download sequence
Identical sequences B7JV57
395962.Cyan8802_3184 41431.PCC8801_2912 gi|218247694|ref|YP_002373065.1| WP_012596175.1.62203 WP_012596175.1.93053 gi|257060969|ref|YP_003138857.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]