SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061049|ref|YP_003138937.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061049|ref|YP_003138937.1|
Domain Number 1 Region: 202-404
Classification Level Classification E-value
Superfamily PheT/TilS domain 9.94e-67
Family B3/B4 domain of PheRS, PheT 0.00000701
Further Details:      
 
Domain Number 2 Region: 36-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.83e-43
Family Myf domain 0.0018
Further Details:      
 
Domain Number 3 Region: 488-701
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.94e-42
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000698
Further Details:      
 
Domain Number 4 Region: 713-811
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 6.54e-31
Family Anticodon-binding domain of PheRS 0.00057
Further Details:      
 
Domain Number 5 Region: 414-495
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000668
Family Domains B1 and B5 of PheRS-beta, PheT 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061049|ref|YP_003138937.1|
Sequence length 812
Comment phenylalanyl-tRNA synthetase subunit beta [Cyanothece sp. PCC 8802]
Sequence
MKISVNWLQELVNVTLPPETLAEILTVAGIEVEEIEDRRQWADGVLIGKIIDRQPHPNAD
KLSVCQVDIGKETPLNIVCGASNARSDIFVAVATLGTYLPQIDLKIKPAKLRGVPSEGMI
CSLAEVGLAKESAGIHIFDDNSLKLGADARPFLGLDDVILDISPTANRADALSMVGVARE
VAALTGGKLSLPQPPDLSLPETSSYRLNVTVEDGNACPAYLGTVIENVKIAPSPEWLQRR
LQAAGVRPINNVVDVTNLVLLEWGQPLHAFDREKLQAIAKNQPLTLGIRFAKDTETLKTL
DDQERTLKPVNLLITANDHPVALAGVMGGQETEVDENTQNIVLEAALFDQVTIRRSSRAQ
SLRSESSARYERGVNQSALEIACRRAIALICELAGGTAVIQVIADNRPDLSTESIILRLE
RVHQVLGPIEKEGTITQIAATDVERILTDLGCHLTLVEGTNKVWRVSVPSYRYRDLEREI
DLIEEVARLYGYDNFCDELPDKSEPGGLSFEYQVQRKVREVFRGVGLTEVVQYSLVKPEK
ADIVLANPLFAEYAALRTNLLDGLIDSFVYNQSQGNGALNAFEIGRIFRIIDGKDQEWDE
IAGIFGGDVFPQGRWTRSGKSVPMTWYEAKGILESVFGRLGLAVTYQADNSDERLHPGRT
ASLWVGKERLGIFGQLHPQLRQEKDLPDAVYVFALNFDILLASLAKEDLITPILRPYSTY
PAVERDLAFFAPLKVSVAELTQVMNKAGGNLLTEVELFDQYQGENVPAGQRSLAFSLAYR
ASDRTLTDGDVEPVHDKIRNALVKQFEVTLRS
Download sequence
Identical sequences WP_015784614.1.62203 395962.Cyan8802_3264 gi|257061049|ref|YP_003138937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]