SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061114|ref|YP_003139002.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061114|ref|YP_003139002.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 7.65e-26
Family Ribosomal protein L28 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061114|ref|YP_003139002.1|
Sequence length 78
Comment 50S ribosomal protein L28 [Cyanothece sp. PCC 8802]
Sequence
MSRKCQLTGKKANNAYAVSHSHRRTKKLQEANLQWKRVWWPEGNRWVRLRLSTKAIKTLE
TKGLSVMAKEAGINLNKI
Download sequence
Identical sequences B7K5N3
gi|218247551|ref|YP_002372922.1| gi|257061114|ref|YP_003139002.1| 395962.Cyan8802_3337 41431.PCC8801_2765 WP_012596033.1.62203 WP_012596033.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]