SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061136|ref|YP_003139024.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061136|ref|YP_003139024.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Pentein 1.36e-55
Family Dimethylarginine dimethylaminohydrolase DDAH 0.04
Further Details:      
 
Weak hits

Sequence:  gi|257061136|ref|YP_003139024.1|
Domain Number - Region: 619-699
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00147
Family Pyruvate oxidase and decarboxylase, middle domain 0.05
Further Details:      
 
Domain Number - Region: 491-605
Classification Level Classification E-value
Superfamily Thiamin phosphate synthase 0.0549
Family Thiamin phosphate synthase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061136|ref|YP_003139024.1|
Sequence length 705
Comment bifunctional protein LOR/SDH [Cyanothece sp. PCC 8802]
Sequence
MTDPIRFLMCAPDHYDVDYVINPWMEGNIHKSTRDRAVEQWQNLYHIIKDRAIVDLVEPQ
KGWPDMVFTANAGLVLGDNVVLSRFYHKERQGEEPHFKKWFEDNGFTVYEMPPDLPFEGA
GDALFDREGRWLWAGYGFRSELDSHPYIAQWLDTEVLSLRLMDERFYHLDTCFCPLTGGY
LLYYPPAFDAYSNRLIELRIPAEKRIVVEEPDAVNFACNAVNINSTIVMNKISDGLQKRL
TDVGFEVVQTSLTEFLKAGGAAKCLTLRVTEPVLDYVHANVPIESRIIQLEGHLLDAGLM
NTALDLIVENGGSFKVMNFNLGVERQSTSAAEVRVSAPSREIMEEIMTELIDLGAVARPQ
EICDVNTEVVTQDGVAPDDFYVSTIYPTEVRFNCEWIKVDNQRMDAAIVVQPTETGATAQ
CKLLRDLKVGDRVMVGVEGIRTIRQPEDREQRNAKKEFTFMGAGVSSERRVELLVEQIAW
EMRQIRDQGGKVAVTAGPVVIHTGGAQHLAHLIRNGYVHALLGGNAIAVHDIEQAMMGTS
LGVDMQRGVPVRGGHRHHLKVINTIRRYGSIAQAVENGVITQGVMYECVKHNVPFVLAGS
IRDDGPLPDTEMDLIKAQAQYSEVLKGSEMILMLSTMLHSIGVGNMTPAGVKMVCVDINP
AVVTKLSDRGSVESVGIVTDVGLFLSLLVQQLDKLTSPYQVAAKV
Download sequence
Identical sequences gi|257061136|ref|YP_003139024.1| 395962.Cyan8802_3360 WP_015784655.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]