SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061157|ref|YP_003139045.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061157|ref|YP_003139045.1|
Domain Number 1 Region: 3-200,231-314
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 7.72e-86
Family ATP synthase (F1-ATPase), gamma subunit 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061157|ref|YP_003139045.1|
Sequence length 314
Comment F0F1 ATP synthase subunit gamma [Cyanothece sp. PCC 8802]
Sequence
MPNLKAIRDRIQSVKNTKKITEAMRLVAAAKVRRAQEQVIATRPFADALANVLYNLLNRL
QYGDVSLPLLQQRQVKTVALVVVSGDRGLCGGYNTYVIRRAEQRQKELEAQGINYRLITI
GRKATQYFSRRQAPIEKTYVGLNQIPTADEAGSIADELLSLFLSETVDRVELIYTRFVSL
ISSRPVVQTLLPLTVQGLEVEDDEVFRLITRDGKLRVERETIAQEVSSFPQDMIFEQDPI
QILDALLPLYINNQLLRGLQEAAASELAARMTAMSNASDNAGQLIGTLTLSYNKARQAAI
TQQLMEVVAGANAL
Download sequence
Identical sequences B7K5I9
gi|218247507|ref|YP_002372878.1| WP_012595989.1.62203 WP_012595989.1.93053 gi|257061157|ref|YP_003139045.1| 395962.Cyan8802_3382 41431.PCC8801_2721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]