SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061184|ref|YP_003139072.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061184|ref|YP_003139072.1|
Domain Number 1 Region: 1-24
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.00000275
Family Ribosomal protein L32p 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061184|ref|YP_003139072.1|
Sequence length 57
Comment 50S ribosomal protein L32 [Cyanothece sp. PCC 8802]
Sequence
MAVPKKKTSKTKRDQRKANWKHQAALEAQKALSLGKSILTGRSTFVYPQDEAEDEDE
Download sequence
Identical sequences B7K5G2
395962.Cyan8802_3409 41431.PCC8801_2694 gi|257061184|ref|YP_003139072.1| gi|218247480|ref|YP_002372851.1| WP_012595962.1.62203 WP_012595962.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]