SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061271|ref|YP_003139159.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061271|ref|YP_003139159.1|
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Ribosomal protein L20 3.27e-51
Family Ribosomal protein L20 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061271|ref|YP_003139159.1|
Sequence length 117
Comment 50S ribosomal protein L20 [Cyanothece sp. PCC 8802]
Sequence
MTRVKRGNVARKRRKKVLKLAKGFRGSHSKLFRTANQQVMKALRNAYRDRRKRKRDFRRL
WITRINAAARVHGISYSKLTGQLKKANIELNRKMLAQLAILDPQAFAKVVETANAAQ
Download sequence
Identical sequences B7K4V4
WP_012595877.1.62203 WP_012595877.1.93053 gi|257061271|ref|YP_003139159.1| gi|218247395|ref|YP_002372766.1| 395962.Cyan8802_3500 41431.PCC8801_2606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]