SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061294|ref|YP_003139182.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061294|ref|YP_003139182.1|
Domain Number 1 Region: 32-92
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000104
Family Alr1493-like 0.019
Further Details:      
 
Weak hits

Sequence:  gi|257061294|ref|YP_003139182.1|
Domain Number - Region: 83-118
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0379
Family Apolipoprotein 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061294|ref|YP_003139182.1|
Sequence length 134
Comment hypothetical protein Cyan8802_3525 [Cyanothece sp. PCC 8802]
Sequence
MVIGQPKYCENSPMSVNAEFKVSAPPFRWDESGGIRIGQSRVTLDSLLAAYHSGFTPEEI
AFQYSVLHLEEIYSAIAYYLNHRQQIDKYLEQRRQKAQQQRSEFVEQYNLADLRQRLSDR
YQTQGELKGDASIG
Download sequence
Identical sequences B7K4T1
395962.Cyan8802_3525 41431.PCC8801_2581 gi|257061294|ref|YP_003139182.1| gi|218247372|ref|YP_002372743.1| WP_012595854.1.62203 WP_012595854.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]