SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061304|ref|YP_003139192.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061304|ref|YP_003139192.1|
Domain Number 1 Region: 581-679
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.84e-27
Family Flavin-binding PAS domain 0.017
Further Details:      
 
Domain Number 2 Region: 435-525
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000156
Family Heme-binding PAS domain 0.054
Further Details:      
 
Domain Number 3 Region: 375-426
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000589
Family HAMP domain 0.0064
Further Details:      
 
Domain Number 4 Region: 761-965
Classification Level Classification E-value
Superfamily PP2C-like 0.000000798
Family PP2C-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061304|ref|YP_003139192.1|
Sequence length 967
Comment PAS/PAC sensor protein [Cyanothece sp. PCC 8802]
Sequence
MLITLLQKFQYKIPLRTVLVVPFVIQIVGAVGLVGYLSFRNGQKAVEDLAGQLTNEVSNV
IIERLNSYLGTPHLVNQLNKNALNLGQLNLQNIKAIERHFWQQAQVFELVSKIQFAGVDG
KFIGLAINDDGTLDYQERDRSGDLQTYAINSQGNRRERLRTYIGFDARLQPWYIASERAG
KPVWSQIYPWVSPPTLAITLGESYYDKNGKFQGVLATDLTLLQISDFLRSLKIGRSGKTF
IIESSGQLVASSSAKSPFLMVDNQPQRLSATNLEDSLIRPAAFYLQKTLGNIKTASPEDI
IPIDIPQKLKFKIHGKHHFMKVLPFQDDFGLDWYIVIVVPESDFMQQIEANNKTTFALVI
AALILATTLGLLTSRWIVELILQLNQAAQQIAEGNLKTKVNIKGIKELESLGITFNVMAN
QIKDYFEALEAKNEDLEQAKADLLEAKEKLETILDAVPGSISWIDSQGFYLGVNRYLSDK
WNLPAEEFIGKPIGFLQGNDHLIEFLFSFLESSKDADSQVVEITFNDCLEYYLIAAQKYQ
GGNATVSIGINITERKKAEEKLTQTVKELSDIKYALDQLAIVTITDAQGNINYVNDKFCE
VSQYSPEELIGNNHRILKSGYHDRAFYKELWSTISSGQIWQGEIKNKTKDGAFYWVNSTI
IPFLDKTGRPFQYLSIRTEITARKELEQTLESIVSKRTAQLAAANQEITDLNNKLRLENV
RMSAELNVVFQMQQMILPKVEELRGIEGLELAGFMKPAAEVGGDYYDVLHHDGIVTLGIG
DVTGHGLESGILMVMTQTAVRTLKEIGETDPIRFLSALNRTIYQNLQRMNSDKNLSLGIL
HYYQRQLRISGQHEEILLVRSGGKIERINTIDLGFPIGLDHDISHFVDQVCVELNPGDGV
ILYTDGITEAKDINRNFYGLNRLCDVVSQSWQKSAQEIQEAVIEDVYQHIGEQKVFDDIT
LLVLKQK
Download sequence
Identical sequences B7K4S0
gi|257061304|ref|YP_003139192.1| WP_012595843.1.62203 WP_012595843.1.93053 gi|218247361|ref|YP_002372732.1| 395962.Cyan8802_3536 41431.PCC8801_2570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]