SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061401|ref|YP_003139289.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061401|ref|YP_003139289.1|
Domain Number 1 Region: 136-300
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.13e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000409
Further Details:      
 
Domain Number 2 Region: 393-504
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000154
Further Details:      
 
Domain Number 3 Region: 6-132
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.58e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.00021
Further Details:      
 
Domain Number 4 Region: 273-405
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061401|ref|YP_003139289.1|
Sequence length 513
Comment ferredoxin-nitrite reductase [Cyanothece sp. PCC 8802]
Sequence
MVQATEINQPVSLNKFEKFKAEKDGLAVKDQLDHFAQIGWEAMDKTDLEHRLKWLGIFYR
PVTPGKFMLRMRTPNGILTSEQLKVLGQIIQRYGDDGNADITTRQNLQLRGIRLEDIPDI
FRRLKAVSMTSMQSGMDNVRNITGSPMAGLDGNELIDTRDLVQKVQDMITNHGEGNYQFT
NLPRKFNIAIEGGRDNSVHAEINDIAFVPAYKDGQLGFNVLVGGFFSAKRCEAAIELDVW
VPPNDDVVELCRAILTVYRNHGPRANRQKSRLMWLIDEWGIEEFRAKVAAEFGRPLATAA
EKDEIDWEKRDHIGVFAQKQPGLNYVGLHIPVGRLYAEDMIDLARLAEVYGGGEIRLTVE
QNVIIPNIPDENLNPFFAEPLLQKFSINPPSLERSLVSCTGAQFCNFALVETKNRALALS
RELDKVLDIPQPVRIHWTGCPNSCGQPQVADIGLMGTKVRKNGKTVEGVDLYLGGKVGKD
AQLGTCVQKGIACEDLLPVLQQLLIDNFGAKLK
Download sequence
Identical sequences B7K3T8
gi|218247263|ref|YP_002372634.1| 395962.Cyan8802_3641 41431.PCC8801_2468 WP_012595745.1.62203 WP_012595745.1.93053 gi|257061401|ref|YP_003139289.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]