SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061423|ref|YP_003139311.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061423|ref|YP_003139311.1|
Domain Number 1 Region: 26-228
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-42
Family Voltage-gated potassium channels 0.00025
Further Details:      
 
Weak hits

Sequence:  gi|257061423|ref|YP_003139311.1|
Domain Number - Region: 238-261
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0553
Family Rubredoxin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061423|ref|YP_003139311.1|
Sequence length 271
Comment ion transport 2 domain-containing protein [Cyanothece sp. PCC 8802]
Sequence
MVDQPITLKKKLSHYLDDFDSLTGIIINLIILGLILLSFLIFVVETYPISESLLIRLKQL
DKIILLVFTLEYIIRFWCSDNKLRFLFSFFSWIDLLAIVPLFVGFLDIRYILIIRWFRIL
RLIRLIELATFLLKIKTEDGVILTRIFLSLLSLVFIYSGAIYQIEHQTNPQIFQNFFDAL
YFSIVTMTTVGFGDVTPLSETGKFITLMMILSGIILIPWQISILTQQLLKITNKSPKLCF
HCGLTVHEHDANFCKICGAKLENNEQIISQR
Download sequence
Identical sequences 395962.Cyan8802_3664 WP_015784811.1.62203 gi|257061423|ref|YP_003139311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]