SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061429|ref|YP_003139317.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061429|ref|YP_003139317.1|
Domain Number 1 Region: 222-483,524-687
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-32
Family Tandem AAA-ATPase domain 0.058
Further Details:      
 
Domain Number 2 Region: 721-829
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.27e-28
Family Pentapeptide repeats 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061429|ref|YP_003139317.1|
Sequence length 830
Comment pentapeptide repeat-containing protein [Cyanothece sp. PCC 8802]
Sequence
MIASNFIVTELFHQSGEAGERVVWEAIQRVFYGRECLAYWRYPLFLGKGKFRKEPDILIA
DRELGLIIIEVKSLKINQIISIQGHRWQYKNFYTKFGNPYQQAENQLFALLDYAKTEPSL
DNQVTGRVMVALPLITQQQWQEKEFDKLPSNPPILFKNSLDSSALLFELIEKTTPVLKRE
KLSNQQWELLTSILSGTPVLSQPIHRVLSGSQSRGKILQELRSQVSQLDLQQEKIGKQIP
PGCQRIRGIAGSGKTVLLCQKAAIMHLKYPQWKIAFVFFSRSLYEEIITHIDRWIRYFSH
NQQGYDPNNRNLRVFHAWGSEKKLGFYRFVSQVCGKTSLSVNQTTRQKPNEALGEVCYDL
LNKTAIPQIFDAILIDEGQDLMVDHWHYQGKQPFYWLAYQSLRPVNSMYPEQKRLIWAYD
EVQSLDSLKMPTAREMFGEELGHLVTGKHFNGINKTEVMCRCYRTPHRIIIAGHAMGMGW
LRPEGMLTGMRHKEEWQALGYEVAGELISGNNIIITRSKENSLNPLPFLWKDDLIKFQIY
SSRQQEMSALYRHLKHNLRQDGLRPSKEILVIVLGEFFEAANLQKNIANFLIRQGIDIFI
PGTKDCNILTHESEENCDQFWCAGGVTISRIYQAKGQEADQVYIIGLDHIAEEESNLSLR
NQLFIALTRSRGWVNISGIGNYPLYQELQNVLNNGDTFSVTFAEPQQREIIGTDEGELLK
SYSLGRRNFEQAALQNAQLDRVNLSDINLIGANLSGARFNYTNLNRAKLIAANLQGADLT
GASLIKAKLMGANLKGANLQEANLTQADLSNVDLTGALVEPEQLEKAIFE
Download sequence
Identical sequences gi|257061429|ref|YP_003139317.1| WP_015784817.1.62203 395962.Cyan8802_3670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]