SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061473|ref|YP_003139361.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061473|ref|YP_003139361.1|
Domain Number 1 Region: 10-460
Classification Level Classification E-value
Superfamily L-aspartase-like 2.04e-146
Family L-aspartase/fumarase 0.00000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061473|ref|YP_003139361.1|
Sequence length 462
Comment argininosuccinate lyase [Cyanothece sp. PCC 8802]
Sequence
MTKQKTWSDRFEGSLHPAIVEFNASIGFDIELIEYDLTGSIAHAQMLAHTGIISPEEAQK
LTQGLEQIRQEYRQGEFKPGIDQEDVHFAVERRLTEIVGDVGKKLHTARSRNDQVGTDIR
LYLRDQISQIRAQLREFQQVLVNHAENHIETLIPGYTHLQRAQPISLAHHLLAYFQMAQR
DWERLGEIYARTNISPLGCGALAGTTFPIDRHYSAELLQFQGVYGNSLDGVSDRDFAIEF
LNAASLIMVHLSRLSEEMILWSSHEFSFISLTDSCATGSSIMPQKKNPDVPELVRGKAGR
VFGHLQGMLVLMKGLPLAYNKDLQEDKEAIFDGVKTVKVCLEAMTILLAEGIKFREERLA
EAVSEDFSNATDVADYLAAKGIPFREAYNLVGKVVKTSSAAGKLLKDLSLEEWQALHPAF
EADIYDAIAPKQVVAARNSYGGTGFEQIRQAITRAKAQLESS
Download sequence
Identical sequences B7K2S1
gi|257061473|ref|YP_003139361.1| gi|218248407|ref|YP_002373778.1| 395962.Cyan8802_3714 41431.PCC8801_3660 WP_012596880.1.62203 WP_012596880.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]