SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061475|ref|YP_003139363.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061475|ref|YP_003139363.1|
Domain Number 1 Region: 44-222
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000207
Family GAF domain 0.0084
Further Details:      
 
Domain Number 2 Region: 346-468
Classification Level Classification E-value
Superfamily PP2C-like 0.0000575
Family PP2C-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061475|ref|YP_003139363.1|
Sequence length 474
Comment protein serine/threonine phosphatase [Cyanothece sp. PCC 8802]
Sequence
MTAVPISRQPYPAKNTPARGLKTDATPVFALKELVASLYREQNKIQNLLSSLGFALRSFN
NLNQFLELTPLMTARVTDADGSALILYKPNGQVSLEQLHCQDHQMGQEIQQVLTKIINQI
NNQSATPVLPASLDEQIRHQLGTKIRLYSTPILVKNIERGRLYVFSINPEYIWTQTRRKL
LQLVADQTAVAIANNELTVELRSKERQDRELEIASDIQLRLLPRKCPTIQGVELAARCET
ANRVGGDYYDFIPTNYDQLRQDQGSKGQESANGVPWSIVIGDVMGKGVPAGLIMTMTRGM
LRAEVLNRHSPGQILQHLNRVMYADLENSHRFVTLFYSEYDPKTRCLSFSNAAHNPPLWW
KASTQEIAKLDTEGMLIGLDADSEYGDGQVQLAPGDTVIYYTDGFTDAVSQKGDRFDEEN
LIQAFQTACQQGNNSEGILDYLFEQIKQFVGSENNNSDDMTLVVMQVKSSENWV
Download sequence
Identical sequences B7K2S3
395962.Cyan8802_3716 41431.PCC8801_3662 gi|257061475|ref|YP_003139363.1| WP_012596882.1.62203 WP_012596882.1.93053 gi|218248409|ref|YP_002373780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]