SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061533|ref|YP_003139421.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061533|ref|YP_003139421.1|
Domain Number 1 Region: 33-242
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 4.19e-22
Family Isochorismatase-like hydrolases 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061533|ref|YP_003139421.1|
Sequence length 247
Comment isochorismatase hydrolase [Cyanothece sp. PCC 8802]
Sequence
MATTLRNPDTALAIIETALPIAPQPYTISDRPTGLVIVDVINGFCTVGYGPLAPTEPDEQ
IATMVIESDRLAKLFIERGCPILLFLDSHEPGKPEPPYPPHCEQGTGEEKLVSELEWLEN
HPQATLINKDCINGFVGSIDINSQRNLFLEWVRQHQLETLIVLGICTDICVMDFVITLLS
VRNHDLLPTLRDVVVYDKGCATYNLTAEMVTALGLPKTAIHPQKIAHHIGLYTMAERGAV
IASEISF
Download sequence
Identical sequences WP_015784869.1.62203 395962.Cyan8802_3779 gi|257061533|ref|YP_003139421.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]