SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061553|ref|YP_003139441.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061553|ref|YP_003139441.1|
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily CheY-like 1.99e-27
Family CheY-related 0.0022
Further Details:      
 
Domain Number 2 Region: 185-391
Classification Level Classification E-value
Superfamily PP2C-like 0.00000157
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061553|ref|YP_003139441.1|
Sequence length 393
Comment response regulator receiver modulated serine phosphatase [Cyanothece sp. PCC 8802]
Sequence
MTDSPINVLLIDDQPMIGEAIRRMLGTEPDIIFNYCRDPTQAIKRALEVKPTVILQDLVM
PDIEGLTLVRFLRAKDAPTHEIPLIVLSSKEDPQIKAKAFNLGANDYLVKLPDKAELIAR
IRYHSTAYINLLKRKEAEERLKEENLRLSAEIEITRKLQQMILPKEEELKQIEGLDIAGY
MEPATDVGGDYYDVLHHNGRVKIGIGDVTGHGLESGVLMIMVQTAIRTLMSRNETDPLKF
LAVVNRTIYENVKRINSDKNLTLSLLDYENNCLRLSGQHESIIVVRSGGKIEIIDTIDLG
FPVGLEEDISEFLGQTEIYLNPGDGVVLYTDGITEAENPQGELYELDRLCQVISKNWEQS
AQEIKEAVIEDVQQHIDTQTVYDDITLLVIKQK
Download sequence
Identical sequences B7K304
gi|257061553|ref|YP_003139441.1| WP_012596963.1.62203 WP_012596963.1.93053 gi|218248490|ref|YP_002373861.1| 395962.Cyan8802_3802 41431.PCC8801_3753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]