SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061562|ref|YP_003139450.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061562|ref|YP_003139450.1|
Domain Number 1 Region: 38-184
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.49e-42
Family Pentapeptide repeats 0.00019
Further Details:      
 
Domain Number 2 Region: 161-336
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.02e-38
Family Pentapeptide repeats 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061562|ref|YP_003139450.1|
Sequence length 343
Comment pentapeptide repeat-containing protein [Cyanothece sp. PCC 8802]
Sequence
MSTLIENLLIGTMSNPGLIKTAPMDAQELIWLYGQGQRDFSRQDLQSEDIIQAILTEANL
SRTALDWANLSGTDLSRANLNRADLIHAKLISAKLVGVDLTGADLSHADLSWVNLEGSTL
ISANLSNANLRQTNLTNADLRSANLSGANLSGANLSGAKLSRADLSEADLSGVDLSGANL
SRADLSEADLMEVDLSYSNLYKADLSESKLRNSDLEEAFLQGANFSRANLKGADLSRAVL
RENTLSLLTLSEFNVQSVNLSNEIDLSSANLRGCNLRGAILRHANLGYGLLHKTNLIDAI
LREANMIDASLRGGDLRGAKFRNSNINAINLMEAIMPDGSIHP
Download sequence
Identical sequences B7K312
gi|257061562|ref|YP_003139450.1| 395962.Cyan8802_3811 41431.PCC8801_3762 gi|218248498|ref|YP_002373869.1| WP_012596971.1.62203 WP_012596971.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]