SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061597|ref|YP_003139485.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061597|ref|YP_003139485.1|
Domain Number 1 Region: 985-1266
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.08e-100
Family WD40-repeat 0.00000317
Further Details:      
 
Domain Number 2 Region: 823-1065
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.96e-89
Family WD40-repeat 0.00000454
Further Details:      
 
Domain Number 3 Region: 1218-1415
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.67e-68
Family WD40-repeat 0.0000161
Further Details:      
 
Domain Number 4 Region: 785-823
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000759
Family Pentapeptide repeats 0.011
Further Details:      
 
Domain Number 5 Region: 346-499
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000355
Family G proteins 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061597|ref|YP_003139485.1|
Sequence length 1443
Comment pentapeptide repeat-containing protein [Cyanothece sp. PCC 8802]
Sequence
MFIIDDIIAELVSQAVNEAEKKANHSERVLRILKKFNLSPDSPPNDIEGIYKYTLVEYGV
DQPKAVLDLFREAAIQKAFSDAFSNNNYALLQQQVDKGIDSYAWGDEIKRLNIDYQKELT
QFSILFVEIVKRTRTATEILESNKLESLQRQLNTVQQQIKTLPLSQLYQQLALIANNTQA
LLPAVEETRETQLAKNIKQWFKTLNYTFEGYEQYNDDYFEFVINIPVRRGYDRIFVRGVE
AEASIKDVNEVIKLVKTHRTDEGWIVAPRRIASAAKNIAKTNNNVYCYTFDELIDDNANF
TQYFNWLEDYVKTREIEKFYVPLACRKEEIDPDTKHKLGMSIYDEKEGWIEGYIDRWLDD
PVKEHISILGEFGTGKTWFVFHYAWQKLQEYQKAKERGTQRPRLPLVIPLRDYAKAVTVE
SLLSEFCFRKHEIGLPGYTAFEQLNRMGKLLIIFDGFDEMADRVDRQKMINNFWELAKVI
VPGAKAILTCRNEHFPEAKEGRALLNAELKASVANLTGEPPQFEILELEKFNNHQIRTVL
EKRTDGDTIERIMANAELLDLARRPLMIELILAAMPDIEAGKAIDISRIYWYAVRRKLEQ
DIKQERTFTSIADKLYFMCELAWEMLSTDQMSLNYRQFPDRLRRLFSQEVQEQKDLDHWH
YDMMGQTLLTRNSEGDYMPAHRSLLEFFVAYKFAVELNILAPDFAEEEDLKRFNSPVSPL
DLSKTFGKQPLSKAVLDLLIPMMEPGEQTITKLKEVVMATQGQTPETVGYLGGNGVTLLL
KLNCSSLIRQNLRETVILGADFSQAILHQVDFTGANLTETRFANLLGGVLTLAFSPDGQW
LATGDRQGVVRVWDAVTGKEVLTCRGHHYSVWSVAWSGDSQTLASSSDDKTIKLWDVSTG
NCRLTLTGHHYSVSSVAWSGDSQALASCSYDKTIKLWDVSTGNCRLTLTGHDAWVSSVAW
NGNSQTLASGSGDNTIKLWDLSTGECHLTLTGHDDSVSSVAWSGDSQTLASCSYDKTIKL
WDVSTGLCRLTLTGHHGWVSSVAWSGDSQTLASGSSDKTIKLWDVQTRQCRLTLTGHDDW
VSSVAWSGDSQTLASGSEDKTIKLWDVSTGNCRLTLTGHDASVSSLAWSGDSQTLASGSY
DHTIKLWDVSTGLCRLTLTGHHGSVYSVAWSGDSQTLASGSEDKTIKLWDVSTGNCRLTL
TGHHGWVSSVAWSGDSQTLASGGDDTIKLWDVSTGNCRLTLTGHHGWVYSVAWSGDSQTL
ASGGDDTIKLWDVSTGNCRLTLTGHDDLVCSVAWSRDSQTLASGSSDKTIKLWDVSTGEC
RLTLTGHDASVSSVAWSGDSQTLASGSSDKTIKLWDVSTGECRLTLTGHDDLVWSVAWSR
DSQTLASCSRDGTIKLWDVQTGKCLQTFDNHPYWGMNITGVQGLSDAEIATLKALGAVEV
NDH
Download sequence
Identical sequences gi|257061597|ref|YP_003139485.1| WP_015784910.1.62203 395962.Cyan8802_3846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]