SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061771|ref|YP_003139659.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061771|ref|YP_003139659.1|
Domain Number 1 Region: 26-126
Classification Level Classification E-value
Superfamily DsrEFH-like 0.0000000000000089
Family DsrH-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061771|ref|YP_003139659.1|
Sequence length 126
Comment hypothetical protein Cyan8802_4026 [Cyanothece sp. PCC 8802]
Sequence
MKALQIIESAYRCIVEEQDDPAIWIVQVLKTAGGEVDILLKGNAVNYAVSGQGNDGLTLG
SWQQTCPAKVDQDLQQALDAGIKVYAIAEDITIRGIPEAQLLGGIEKLSRHELPSLFEQY
QQVWHW
Download sequence
Identical sequences B7K597
WP_012597177.1.62203 WP_012597177.1.93053 395962.Cyan8802_4026 41431.PCC8801_3984 gi|257061771|ref|YP_003139659.1| gi|218248708|ref|YP_002374079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]