SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061783|ref|YP_003139671.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061783|ref|YP_003139671.1|
Domain Number 1 Region: 104-314
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.83e-59
Family BC ATP-binding domain-like 0.00000413
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.01e-35
Family BC N-terminal domain-like 0.000044
Further Details:      
 
Domain Number 3 Region: 325-419
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 6.28e-32
Family BC C-terminal domain-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061783|ref|YP_003139671.1|
Sequence length 423
Comment phosphoribosylamine/glycine ligase [Cyanothece sp. PCC 8802]
Sequence
MKILVIGNGGREHALAWKLLQSPQVKQCFCLPGNGGTALLKGCQNIPIAVDNLEEIAKIA
HQESIDLVVVGPEVPLSLGISDRLQQDGIKVFGPTQQGAQIESSKSWAKTLMAEAGVPIA
QGQSFTDPITAKAYITQHGAPIVVKADGLAAGKGVIVAATVEEAQSAVDSLFQEGFSLIV
VEECLVGEEVSILALSDGITVRPLLPAQDHKRIGEGDTGPNTGGMGTYCPAPIGTPELLQ
RVQREVLEPTVAALRNRGIDYRGVLYAGLMVSPDGEPKVLEYNCRFGDPETQVVLPLLET
PLDELILACVEQRLGELPPLAWKSGTAVCVVAASGGYPGNYTKGKVITGIEQAEALGVTV
FHAGTKLDGDRLLTDGGRVLGITAMGEDFDHAIHQVYQGVNCIEFEGQYYRRDIGHRAVD
RQQ
Download sequence
Identical sequences B7K5B0
WP_012597190.1.62203 WP_012597190.1.93053 395962.Cyan8802_4039 41431.PCC8801_3997 gi|257061783|ref|YP_003139671.1| gi|218248721|ref|YP_002374092.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]