SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061928|ref|YP_003139816.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061928|ref|YP_003139816.1|
Domain Number 1 Region: 17-69
Classification Level Classification E-value
Superfamily Rubredoxin-like 4.71e-21
Family Rubredoxin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061928|ref|YP_003139816.1|
Sequence length 115
Comment rubredoxin-type Fe(Cys)4 protein [Cyanothece sp. PCC 8802]
Sequence
MSERPTEKTLAEQAPANHECRLCGYVYEPKKGDAKGNIDPGTPFEDLPITWRCPVCGARS
NQFSNVGATNAPSGFQENLNYGFGVNNLTPGQKNLLIFGGLALGFLFFLSLYGLN
Download sequence
Identical sequences B7K628
WP_015785132.1.62203 WP_015785132.1.93053 gi|218248866|ref|YP_002374237.1| 395962.Cyan8802_4189 41431.PCC8801_4149 gi|257061928|ref|YP_003139816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]