SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061933|ref|YP_003139821.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257061933|ref|YP_003139821.1|
Domain Number - Region: 315-343
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.00134
Family Rubredoxin 0.024
Further Details:      
 
Domain Number - Region: 119-166
Classification Level Classification E-value
Superfamily Hypothetical protein TM0160 0.0157
Family Hypothetical protein TM0160 0.015
Further Details:      
 
Domain Number - Region: 48-109
Classification Level Classification E-value
Superfamily Aspartate receptor, ligand-binding domain 0.0602
Family Aspartate receptor, ligand-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257061933|ref|YP_003139821.1|
Sequence length 383
Comment transposase, IS605 OrfB family [Cyanothece sp. PCC 8802]
Sequence
MSNKAYRFRLYPNQEQQQFLAKCFGCSRFVYNHFLRLTTDVYADGKKNLRYKEWAKLLTS
LKKEFEWLKDVNSQALQQTLKDLETAYSRFFKGLAKFPQFKKRSNKQSFRIPQHFSLTED
RKLKLPKMSPIKMVIHREIEGEIKSVTISKTPSGKYYASIVTELDIPKAPLNGEKIGMDL
GIKEFAITSKPEKFENPRYFQRSLRRLKIRQRRLSRRVKGSNNRNKARVRVAKIHEKVAN
QRLDYQHKISLKLTNENQVISCEDLNIKGMVKNRKLSRQISDVAWGQFLTLLEYKGDIYG
CEIKPVKRCFPSSKRCSNCGYIKEDLTLKDREWTCPECHVHHDRDINACHNLLQFSDGYI
GWEAPKSTPNQTVEMQCIKSVSS
Download sequence
Identical sequences 395962.Cyan8802_4194 WP_015785137.1.62203 gi|257061933|ref|YP_003139821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]