SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061935|ref|YP_003139823.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061935|ref|YP_003139823.1|
Domain Number 1 Region: 41-131
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.84e-26
Family Pentapeptide repeats 0.001
Further Details:      
 
Domain Number 2 Region: 138-204
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000987
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061935|ref|YP_003139823.1|
Sequence length 261
Comment pentapeptide repeat-containing protein [Cyanothece sp. PCC 8802]
Sequence
MKAIIATTTAILTAFSFSMAAKAENLEHLNRLLSTKQCPLCDLSGAGLVMVDLSGAKLIG
ANLAGANLSQANLSGADLSGANLSGASLHGANLIGANLSSAILNGTDLREAYLSNAIIVG
TKLDAAYVQGAEGIPNNAGTRELFYEWGLIETKQGNYQKALDHYNKALLMDAEYAPVYLA
RAYALLRLGNEAGATENAAIASQLFAKQENPQGQEMSDTFVKNLETFQEVRKKEKEGNNA
QLDNFVRGAASLMLRLFLGGM
Download sequence
Identical sequences B7K635
gi|218248873|ref|YP_002374244.1| WP_015785139.1.62203 WP_015785139.1.93053 gi|257061935|ref|YP_003139823.1| 395962.Cyan8802_4196 41431.PCC8801_4156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]