SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257061944|ref|YP_003139832.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061944|ref|YP_003139832.1|
Domain Number 1 Region: 358-542
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.18e-62
Family Pyruvate oxidase and decarboxylase PP module 0.0000396
Further Details:      
 
Domain Number 2 Region: 3-174
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.66e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000243
Further Details:      
 
Domain Number 3 Region: 182-363
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.08e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061944|ref|YP_003139832.1|
Sequence length 550
Comment acetolactate synthase [Cyanothece sp. PCC 8802]
Sequence
MGELTTAELLVQCLENEGVEYIFGLPGEENLHILQALKHSSIKFITTRHEQGAAFMADVY
GRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDRMHIESHQYLDLVAM
FAPVTKWNKQIVRPSITPEVARKAFKLAQSEKPGAVHIDLPENIAAMPVEGQPLKRDSQE
KTYASYRSLNAAAMAISKAQNPLILVGNGTIRANASESLTEFATALNIPVANTFMGKGVV
PYTHPLALWTLGLQQRDIITCAFEGCDLVIAVGYDLIEYSPKKWNPDGKTPIIHIGMAPA
EIDSSYIPLVEVVGDISDSLMDILKRADRHGKSTAIASGLRAQIVEDYERYAQDEGFPVK
PQKIIYDLRQVMGPEDIVISDVGAHKMWMARHYHCDCPNTCLISNGFAAMGIAIPGAIAA
KLVHPDKKVVAVTGDGGFMMNCQELETALRVGTPFVTLIFNDNGYGLIEWKQLNQFGESA
FIRFGNPDFVKFAESMGLKGYRVESASDLIPTLKMALAQDVPAVIDCPVDYGENIRLSQK
SGDLSCQIWE
Download sequence
Identical sequences B7K645
395962.Cyan8802_4208 41431.PCC8801_4168 WP_015785148.1.62203 WP_015785148.1.93053 gi|257061944|ref|YP_003139832.1| gi|218248883|ref|YP_002374254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]