SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257062179|ref|YP_003140067.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257062179|ref|YP_003140067.1|
Domain Number 1 Region: 174-397
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 1.83e-92
Family Argininosuccinate synthetase, C-terminal domain 0.00000129
Further Details:      
 
Domain Number 2 Region: 5-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.65e-43
Family N-type ATP pyrophosphatases 0.00000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257062179|ref|YP_003140067.1|
Sequence length 399
Comment argininosuccinate synthase [Cyanothece sp. PCC 8802]
Sequence
MGRADKVVLAYSGGVDTSVCIPYLKNEWGVKEVITLAADLGQGDELGPIQAKALRCGAVE
SLVTNAQEEFVTEYAFRAIKANALYENRYPLSTALARPLIAKLLVEAAEKYGADAVAHGC
TAKGNDQVRFDLGILALNPNLKVLAPAREWNMSREETIAYGERCGVESPVKKSSPFSIDR
NLLGRSIEAGPLEDPMTEPPEEIYLMTKAIADTPDTPEYVDIGFEKGIPVSLNGQTLDPV
SLISQLNEKVGNHGVGRLDMIENRVVGIKSREIYEAPALLVLIDAHRDLESLTLTADVTQ
YKHGVGDTYSQLIYRGLWYSPLKTALDALIDQTQERVTGMVRVKLFKGNAVIVGRQSENS
IYSANLSTYGSDDAFDHKAAEGFIYIWGLPTRVWAQKTK
Download sequence
Identical sequences B7JVH4
WP_015785362.1.62203 WP_015785362.1.93053 gi|257062179|ref|YP_003140067.1| 395962.Cyan8802_4448 41431.PCC8801_4385 gi|218249092|ref|YP_002374463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]