SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257062180|ref|YP_003140068.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257062180|ref|YP_003140068.1|
Domain Number - Region: 23-80
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00162
Family GSPII protein E N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257062180|ref|YP_003140068.1|
Sequence length 93
Comment hypothetical protein Cyan8802_4449 [Cyanothece sp. PCC 8802]
Sequence
MGFSNLSESPAISLVLLFNTSAMMTKFPSLIHFLQKELAIPADSIALALRDKPSHGHQLI
MTLWQYGLVTKEQLEHLFDWLDSNTFLDVVDSF
Download sequence
Identical sequences B7JVH5
395962.Cyan8802_4449 41431.PCC8801_4386 gi|218249093|ref|YP_002374464.1| gi|257062180|ref|YP_003140068.1| WP_015785363.1.62203 WP_015785363.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]