SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257058200|ref|YP_003136088.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058200|ref|YP_003136088.1|
Domain Number 1 Region: 30-179
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.92e-41
Family Pentapeptide repeats 0.00023
Further Details:      
 
Weak hits

Sequence:  gi|257058200|ref|YP_003136088.1|
Domain Number - Region: 229-270
Classification Level Classification E-value
Superfamily Proteasome activator 0.0173
Family Proteasome activator 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058200|ref|YP_003136088.1|
Sequence length 279
Comment pentapeptide repeat-containing protein [Cyanothece sp. PCC 8802]
Sequence
MANQDHIDLLTRSVEIWNEWRDNNIDVIPDLQGANLSHNDLRNANLIGANLEGAILYGVN
LTGAFLRKASLRNADLTSATCFRTMLGKADLSYAFLTNADLSKAYLSKANLTGAYLIECY
LVDTNLQEAILFEADLSNAYLTGANLEQANLEKANLVKADLSGAKITGANFEGANMTDII
CANSLANDESYETTINVSQIMESVVQSTHQRVNYNNKVSVNSLDRSSCVQEDIIGKMERL
EFENITLKLQIQKIYEERSHLLQEISKLTNSISKYSVNN
Download sequence
Identical sequences B7K369
395962.Cyan8802_0289 41431.PCC8801_0289 WP_012593666.1.62203 WP_012593666.1.93053 gi|257058200|ref|YP_003136088.1| gi|218245174|ref|YP_002370545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]