SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257060035|ref|YP_003137923.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257060035|ref|YP_003137923.1|
Domain Number - Region: 186-250
Classification Level Classification E-value
Superfamily Folate-binding domain 0.0392
Family Aminomethyltransferase folate-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060035|ref|YP_003137923.1|
Sequence length 332
Comment hypothetical protein Cyan8802_2207 [Cyanothece sp. PCC 8802]
Sequence
MTLEMQKLEEENNRIFIEAYGLQDELTPEVPLKEITLTCNPYYRYNSDKPQEELETLLLA
DTIKEFISYSVGCMFGRYSLDKEGLILANQGETLQDYFVKVGSKKWEVRSKEENTPNSSL
DSLHSPLPTSHFPLDPLHFIPTETNVIPILEGDWFSDDITEQFRQFLRVTFGEENYQQNL
NFVEEAIGKDIEKYFVKDFYNDHVKRYKKRPIYWLFSSPKGTFNALIYLHRYRPDTVSIV
LNKYLREFRIKLQARLETLKQIDISASASKTEKTKALRETEQIKKMLRELEDYEQEILYP
LAIEQIEIDLDDGVKVNYTKLGKALKNVTGLS
Download sequence
Identical sequences 395962.Cyan8802_2207 gi|257060035|ref|YP_003137923.1| WP_015784045.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]