SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257093556|ref|YP_003167197.1| from Candidatus Accumulibacter phosphatis clade IIA str. UW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257093556|ref|YP_003167197.1|
Domain Number 1 Region: 120-285
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00073
Further Details:      
 
Domain Number 2 Region: 409-553
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-40
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0017
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 7.85e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.007
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257093556|ref|YP_003167197.1|
Sequence length 569
Comment nitrite/sulfite reductase hemoprotein beta-component ferrodoxin domain-containing protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
Sequence
MYRYDTTDQRIIDERVAQYRDQMARHLAGELSVDELRPLRLQNGLYIQRHGPMLRIAIPY
GMLAAAQLRKLAEISRRYDRGVGHFTTRQNMQLNWPQLEETPDILGELASVEMHAVQTSG
NCVRNITTDHFAGCAPDEITDPRPYCELLRQWSTFHPEFAYLPRKFKIAVNAAADDRAVI
RAHDIGLGLVIDDTGEIGFRVFVGGGLGRTPILGKLIREFLPRRHLLSYLDAILRVYNRY
GRRDNMYKARIKILVQALGIEEFARQVDAEWAYLQDGPTTVPDAEFARIAHHFAPPPWET
LPAEDSAHAARLSSDKAFANWVKRCVHVHKTPGYAAVTLSLKAPGVAPGDITDAQMLAVA
DLADRFSFGELRVTHEQNVVLADIRQRDLYEVWQIARSHRLATANIGLLTDMICCPGGDL
CALANARSIPIADAVQQKFDDLDYLYDIGDISLNISGCMNSCGHHHVANIGILGVDKNNE
EWYQITVGGQQGNAATIGKVIGPSFYAQEVPLVIEALIDVYRENRGDSERFIDTLQRIGI
EPFKARAYAGRDRRRVAKVDSNEKELVNA
Download sequence
Identical sequences C7RM19
gi|257093556|ref|YP_003167197.1| 2000184900 522306.CAP2UW1_1972 2001121660 WP_015766465.1.47741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]