SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257094346|ref|YP_003167987.1| from Candidatus Accumulibacter phosphatis clade IIA str. UW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257094346|ref|YP_003167987.1|
Domain Number 1 Region: 634-796
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 2-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.35e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.001
Further Details:      
 
Domain Number 3 Region: 144-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.04e-30
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0014
Further Details:      
 
Domain Number 4 Region: 521-642
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257094346|ref|YP_003167987.1|
Sequence length 809
Comment nitrite reductase (NAD(P)H) large subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
Sequence
MSRKKLVMVGNGMAGVRTLEELLKIAPDQYEITVFGAEPHPNYNRILLSPVLAGEMTIQD
IILNDHSWYAEHGITLHLGKKVSKIDRVQRRVIAEDGTEAPYDRLLLATGSNPFILPIPG
NNLPGVISYRDIHDTDSMIDAAKSYRHAVVIGGGLLGLEAANGLKLRGMDVTVIHLADWL
LERQLDQTAGRMLQKSLEDRGLKFLLGRQTEMLIAGESGRVAALRLKDGAQIPADLVVMA
VGIRPNTTLAEAAGIHCNRGIVVNDTLQTYDPKVYAVGECVAHRGIAYGLVAPLFEQGKV
AANHLANYGISRYTGSVTSTKLKVTGIDLFSAGDFFGSKDTEEIVLNDAAAGVYKKLVIK
DNRLVGGVLYGDTADGPWYFQLLRDGQDIHEIRDHLLFGQSHVGDVGHQGHSKAAAMADS
AEVCGCNGVSKGTIVKAIKEKGLFSLDDIRKHTKASSSCGSCSGLCEQILSATIGGAYTP
AASNRKPVCGCTDYSHQEVRDAIRGEHLTTIDAIMRFLEWQTPDGCEKCRPALNYYLIST
WPMEARDDPRSRLINERAHANIQKDGTYSVVPRMWGGLTNSAELRRIADVADKYQVPTIK
VTGGQRIDLLGIKKEDLINVWRDLDMPSGHAYGKSIRTVKTCVGAEHCRFGTQLAMAMGV
KLEKMLFDMYSPHKVKLAVSGCPRNCAEAGIKDVGVIGVDSGYELYVGGNGGIKTEVAQF
FVKVKTDDEVMEYAGAFLQLYREEGFYLERTCHYLERVGLEHARNRVVEDEENRKALYGR
LLAELKDAKDPWAERIAGVEKNEYEMLSV
Download sequence
Identical sequences C7RTC5
gi|257094346|ref|YP_003167987.1| 2000158030 522306.CAP2UW1_2777 WP_015767239.1.47741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]