SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257095175|ref|YP_003168816.1| from Candidatus Accumulibacter phosphatis clade IIA str. UW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257095175|ref|YP_003168816.1|
Domain Number 1 Region: 279-411
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 1.57e-31
Family Cell-division protein ZipA, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257095175|ref|YP_003168816.1|
Sequence length 428
Comment ZipA FtsZ-binding region [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
Sequence
MTDLQMGLIGLGGAAVIGVLGYNKWQEHKHRKLAEQLLNVRQADVLLDESPPGGASADDY
AGVDGGAEAADPGAGGGARSAGSGHERVEPLLRVEPAQDDGAYEASAPFAEDSARVAPAF
LSPREAPVAGRSASPQAVPGRPDDAPANAGGQAAPLYLLSPMIDYIAAIEVAEPAAAYRI
REGQRAALVRIGKAVNWIGYNEDSREWEPILEDSDNAYRHIRAGLQLVDRKGPVRDGDLS
VFHVALLDLATELMGVAELPLREPALQAAAQLDEFCAGVDIQIGVNVISQGQVFPGTKLR
ALAESAGMVIDADGRFARCDDEGNVLYVLINQETKGFSSESMRTMTTHGVTFLLDVPRVA
NGDRVLTQMVELARRFAEALHGALVDDNRRPLSESAIEPIRRQVVQYQTAMAHRQLPAGG
PLALRLFS
Download sequence
Identical sequences C7RKG7
522306.CAP2UW1_3630 2000192780 gi|257095175|ref|YP_003168816.1| 2001004410 WP_015768055.1.47741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]